PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI01G01310.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 348aa    MW: 38111.9 Da    PI: 6.0989
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI01G01310.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-172976148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll ++++ +G g+W++ ar+ g++Rt+k+c++rw++yl
  OMERI01G01310.1 29 RGPWTLEEDNLLMNYIACHGEGRWNLLARCSGLKRTGKSCRLRWLNYL 76
                     89********************************************97 PP

2Myb_DNA-binding53.65e-1782125146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T+eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
  OMERI01G01310.1  82 RGNLTPEEQLLILELHSKWGNR-WSRIAQHLP-GRTDNEIKNYWRT 125
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8852476IPR017930Myb domain
SuperFamilySSF466896.36E-3126123IPR009057Homeodomain-like
SMARTSM007171.2E-132878IPR001005SANT/Myb domain
PfamPF002495.9E-152976IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.7E-233083IPR009057Homeodomain-like
CDDcd001677.06E-113176No hitNo description
PROSITE profilePS5129426.28177131IPR017930Myb domain
SMARTSM007171.5E-1581129IPR001005SANT/Myb domain
PfamPF002496.7E-1682125IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.6E-2484130IPR009057Homeodomain-like
CDDcd001672.03E-1286125No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009686Biological Processgibberellin biosynthetic process
GO:0009751Biological Processresponse to salicylic acid
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MSQRRVAGPM GVMSKQQEAM AEEMMELRRG PWTLEEDNLL MNYIACHGEG RWNLLARCSG  60
LKRTGKSCRL RWLNYLKPDI KRGNLTPEEQ LLILELHSKW GNRWSRIAQH LPGRTDNEIK  120
NYWRTRVQKQ ARQLKVDANS TVFRDAVRCY WMPRLLEKMA GAATDPTPPP PPPLHHHAAM  180
AAASSPFDFD THLQQAEATS ACVVPPNVYH IDPSPSTSTS AGSTAAAAAF QPVPCFSELR  240
WDQQMQSSGE LDDGGAGVFV DSASVLGSLS LDGLDLGPAE YYSDSTLLDY LNSSCTGSAM  300
MTMMTASGNA GSYNYCGGGG AMDGDDTWRS DEVCQAAARK LGEWGGGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A1e-26261301104MYB PROTO-ONCOGENE PROTEIN
1a5j_A1e-26261304107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00216DAPTransfer from AT1G68320Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1074240.0AK107424.1 Oryza sativa Japonica Group cDNA clone:002-127-F10, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015633684.10.0PREDICTED: transcription factor MYB108 isoform X1
TrEMBLA0A0E0BWF40.0A0A0E0BWF4_9ORYZ; Uncharacterized protein
STRINGORGLA01G0016500.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19838330
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-77myb domain protein 62